PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_12296A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 329aa    MW: 36602.3 Da    PI: 9.5778
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_12296AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.25.7e-112368146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                               +g+W +eEd  l + v+ +G+++W++I ++  + Rt+k+c++rw +
  Oropetium_20150105_12296A 23 KGPWMEEEDAVLREHVRVHGPRDWSSIRSEGLLPRTGKSCRLRWVN 68
                               79*************************9886677**********87 PP

2Myb_DNA-binding37.64.9e-1279119345
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                +++ +E+   +d+ +++G++ W+ Ia++++ gRt++++k++w 
  Oropetium_20150105_12296A  79 KFSSDEERVVLDLQARFGNK-WAMIAAYLP-GRTDNDVKNFWS 119
                                799*****************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.9091874IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-182071IPR009057Homeodomain-like
SuperFamilySSF466897.81E-2621118IPR009057Homeodomain-like
SMARTSM007171.2E-92272IPR001005SANT/Myb domain
CDDcd001671.34E-102570No hitNo description
PfamPF139214.4E-102675No hitNo description
Gene3DG3DSA:1.10.10.601.1E-1572124IPR009057Homeodomain-like
SMARTSM007171.9E-976124IPR001005SANT/Myb domain
PROSITE profilePS5129414.58578126IPR017930Myb domain
PfamPF002498.3E-1079119IPR001005SANT/Myb domain
CDDcd001678.83E-979118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MARAPVGARR RARAADGWEA VRKGPWMEEE DAVLREHVRV HGPRDWSSIR SEGLLPRTGK  60
SCRLRWVNKL RPNLKSCCKF SSDEERVVLD LQARFGNKWA MIAAYLPGRT DNDVKNFWST  120
RQKRLARLMS PLRPRQFRKN LRLEKAAASS SPESRLAPDP ILETIPLEGS SSGDQFHART  180
AFRNPQKSEQ VPYDQTGSQL FGFGGAPPPV ALATDIQATS SASLWPPQLQ LYPPPYPLLD  240
FPGTWGSSGM APGFVSAGAP YDFAYHQEQF SMMQSSLMTS PFFGMNDGVK IEHRGPPDQF  300
DDLPPDLYNN SADQLPPASS PSRTISDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-2541243126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6630001e-39AL663000.4 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBb0034G17, complete sequence.
GenBankAL7316131e-39AL731613.5 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0065H10, complete sequence.
GenBankAP0149601e-39AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126121e-39CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBankCR8552181e-39CR855218.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0106P14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978165.11e-106PREDICTED: myb-related protein MYBAS2
TrEMBLK3YCT21e-106K3YCT2_SETIT; Uncharacterized protein
STRINGSi012032m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.13e-59MYB family protein